CBU - Computational Biology Unit
 

BOMP is a tool for prediction of beta-barrel integral outer membrane proteins (BOMPs). The user may submit a list of proteins, and receive a list of predicted BOMPs.

Send an email to webtools@bccs.uib.no

>Sequence name
MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGA
FGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGG
MVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDN
GMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQ
LYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGM
GESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
>Sequence name
MQTKLLAIMLAAPVVFSSQEASASDFFGPEKISTEINLGTLSGKTKERVYEPEEGGRKVS
QLDWKYSNAAILKGAVNWELNPWLSVGAAGWTTLNSRGGNMVDQDWMDSGTPGTWTDESR
HPDTRLNYANEFDLNVKGWFLKESDYRLAIMAGYQESRYSFNATGGTYIYSENGGFRNET
GALPDKIKVIGYKQHFKIPYVGLTGNYRYDNFEFGGAFKYSGWVRGSDNDEHYVRQTTFR
SKVINQNYYSVAVNAGYYITPEAKVYIEGVWSRLTNKKGDTSLYDRSDNTSEHNNNGAGI
ENYNFITTAGLKYTF
    
This page is maintained by webmaster@bccs.uib.no. Last updated: Tuesday 12 February, 2008
Unifob logo    UiB logo